General Information

  • ID:  hor006652
  • Uniprot ID:  P83636
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Faxonius limosus (Spinycheek crayfish) (Orconectes limosus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Sinus gland of the eyestalk.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Faxonius (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RYVFEECPGVMGNRALHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA
  • Length:  75(30-104)
  • Propeptide:  MVNQVAQCFTVRRVWLVVVVGLLVHQTTARYVFEECPGVMGNRALHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNAGR
  • Signal peptide:  MVNQVAQCFTVRRVWLVVVVGLLVHQTTA
  • Modification:  T75 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-P83636-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006652_AF2.pdbhor006652_ESM.pdb

Physical Information

Mass: 999222 Formula: C382H594N106O107S9
Absent amino acids: Q Common amino acids: ERVCFGL
pI: 7.05 Basic residues: 12
Polar residues: 21 Hydrophobic residues: 26
Hydrophobicity: -7.33 Boman Index: -13053
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 74
Instability Index: 3604.4 Extinction Coefficient cystines: 8855
Absorbance 280nm: 119.66

Literature

  • PubMed ID:  16269348
  • Title:  Characterization of a molt-inhibiting hormone (MIH) of the crayfish, Orconectes limosus, by cDNA cloning and mass spectrometric analysis.